DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Ppp1cc

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_006530263.1 Gene:Ppp1cc / 19047 MGIID:104872 Length:337 Species:Mus musculus


Alignment Length:299 Identity:279/299 - (93%)
Similarity:289/299 - (96%) Gaps:0/299 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 67
            |.:||||||.|||||||::|||||||.|.||||||||||||||||||||||||||||||||||||
Mouse     5 DKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 69

  Fly    68 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIY 132
            |||||||||||||||||||||||||||||||||||||||||||||.|||||||||||||||||||
Mouse    70 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 134

  Fly   133 GFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQG 197
            ||||||||||:|||||||||||||||:|||||||||||||||||||.||||||||||||||||||
Mouse   135 GFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG 199

  Fly   198 LLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLV 262
            |||||||||||||.:||||||||||||||||||||||.||:.||||||||||||||||||||.||
Mouse   200 LLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLV 264

  Fly   263 TLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301
            ||||||||||||||||||||||:||||||||||||:|:|
Mouse   265 TLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 273/289 (94%)
Ppp1ccXP_006530263.1 MPP_PP1_PPKL 8..298 CDD:277359 273/289 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 395 1.000 Domainoid score I758
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 602 1.000 Inparanoid score I936
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm8882
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R952
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.