DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Ppp1ca

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_114074.1 Gene:Ppp1ca / 19045 MGIID:103016 Length:330 Species:Mus musculus


Alignment Length:297 Identity:277/297 - (93%)
Similarity:287/297 - (96%) Gaps:0/297 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            :|:||||.|||||:|:||||||||:|.||||||||||||||||||||||||||||||||||||||
Mouse     7 LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
            |||||||||||||||||||||||||||||||||||||||||:|.|||||||||||||||||||||
Mouse    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGF 136

  Fly   135 YDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            ||||||||:|||||||||||||||:|||||||||||||||||||.||||||||||||||||||||
Mouse   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264
            |||||||||||..||||||||||||||||||||||.||:.||||||||||||||||||||.||||
Mouse   202 CDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301
            ||||||||||||||||||||:||||||||||||||.|
Mouse   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 271/289 (94%)
Ppp1caNP_114074.1 PTZ00480 6..308 CDD:185658 277/297 (93%)
MPP_PP1_PPKL 8..298 CDD:277359 271/289 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837158
Domainoid 1 1.000 395 1.000 Domainoid score I758
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 602 1.000 Inparanoid score I936
Isobase 1 0.950 - 0 Normalized mean entropy S19
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 1 1.000 - - mtm8882
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R952
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.750

Return to query results.
Submit another query.