DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and Ppef2

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_030110066.1 Gene:Ppef2 / 19023 MGIID:1342304 Length:797 Species:Mus musculus


Alignment Length:361 Identity:95/361 - (26%)
Similarity:138/361 - (38%) Gaps:135/361 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ICGDIHGQYYDLLRLFEYGGFP-PESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGN 122
            :|||:|||..||:.:|...|.| ||..|:|.||:|||||.|:|.:.:|.|:.:.|.:.|.|.|||
Mouse   216 VCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGN 280

  Fly   123 HECASINRIYGFYDECKRRYSI---KLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSME-- 182
            ||...:|..|||..|...:|.|   |:.:|..|.|..||:|.:||||:...|||:| |.|.:|  
Mouse   281 HEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVS-DKTDLELL 344

  Fly   183 ----------------------------------------------------------------- 182
                                                                             
Mouse   345 AKLDRHKIVSTMRCKTRKESENREEQKRKDNQTSSGQKPTPWFLPQSRSLPSSPFHLGSGFKAYK 409

  Fly   183 ---------------------QIRR---------------------------------------I 187
                                 |:||                                       :
Mouse   410 AGRSCSIPCGSPNSKELSRRGQVRRSVDLELEQCRQQAGFLGIREKGESLPLAPDADCVADGGGV 474

  Fly   188 MRPTDVPDQ-GLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVED 251
            :.||  |:: ..:.|:|||||...........||....||.:|..:.::|::..|:.|:|:...:
Mouse   475 LEPT--PEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPE 537

  Fly   252 GYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTL 287
            ||||...|.::|:|||.||.....|.||.:.:...|
Mouse   538 GYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPAL 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 95/361 (26%)
Ppef2XP_030110066.1 IQ 61..80 CDD:197470
MPP_RdgC 162..581 CDD:277364 95/361 (26%)
FRQ1 621..765 CDD:227455
EFh 701..766 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.