DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and R08A2.2

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_506632.2 Gene:R08A2.2 / 187692 WormBaseID:WBGene00011133 Length:371 Species:Caenorhabditis elegans


Alignment Length:304 Identity:119/304 - (39%)
Similarity:181/304 - (59%) Gaps:12/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDVM---NIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDI 63
            ||:.   ::|.:..|::| ...:.|.....::.:|..:..|:.......|.:|::|.|:.|.|||
 Worm     8 GDLYEGESVDQLAKRMIE-HLLKWGVTDAFNDKQIYTILEKAESTLNPLPAMLQVEHPITIVGDI 71

  Fly    64 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASI 128
            |||...|:|.|:..|:||:..:||||||||||.:|.|...||..|||:|..:..||||||||..:
 Worm    72 HGQLDALIRYFDAVGYPPKVKFLFLGDYVDRGAKSFEVSLLLFCYKIRYPHSVHLLRGNHECMKM 136

  Fly   129 NRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDV 193
            ||:||||:|..|:...::|:.:.:.||.||:.|.|.::|.|.|||:|.:..|.|..:.:.:| :.
 Worm   137 NRLYGFYEELARKRGGRMWRQYQNVFNELPLCARVGQRILCMHGGISQNCNSWESFKALKKP-NT 200

  Fly   194 P---DQGLLCDLLWSDPDKD---TMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDG 252
            |   |:||..||:|:||.:|   |....: .|.:|..||.:.:..||:|....||.|||:|.::|
 Worm   201 PLTCDEGLQVDLMWADPTQDKCNTFAMNK-QRAISVVFGEKGLDVFLKKLGLSLIVRAHEVSQEG 264

  Fly   253 YEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKP 296
            :.|...:..||:||||.|||...|.||:|.|.::...||.:|:|
 Worm   265 FNFLFNKKCVTVFSAPYYCGNDTNCGAIMHVSESYEISFTVLRP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 116/295 (39%)
R08A2.2NP_506632.2 PP2Ac 36..308 CDD:197547 112/273 (41%)
MPP_PPP_family 66..295 CDD:277316 102/230 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.