DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and F44B9.9

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:267 Identity:88/267 - (32%)
Similarity:118/267 - (44%) Gaps:78/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EIFLSQPILLELEAPLKICGDIHGQYYDLLRLFE-------------YGGFPPESNYLFLGDYVD 93
            |:|..:..|.|:..|:.|.||||||:.||:||..             | ||..: .::|||||||
 Worm    18 ELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIY-GFSTK-KWVFLGDYVD 80

  Fly    94 RGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLP 158
            ||.:||:.|||:.:.||.:.:.:.|||||||..:||..|||                       .
 Worm    81 RGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF-----------------------R 122

  Fly   159 VAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSF 223
            |.::|..||        |...|.  ||                              .|.||:|.
 Worm   123 VCSVVVLKI--------PAKPSF--IR------------------------------NNKRGLSV 147

  Fly   224 TFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLM 288
            .|....|.:..:.....||.|.||::..|::|||.|.|.|:||||.|..|.||:||:|.|.....
 Worm   148 CFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDNSGAVMKVASNGK 212

  Fly   289 CSFQILK 295
            .|..|:|
 Worm   213 ISISIMK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 88/267 (33%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 87/265 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156430
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.