DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and F23B12.1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_506574.3 Gene:F23B12.1 / 184887 WormBaseID:WBGene00009079 Length:329 Species:Caenorhabditis elegans


Alignment Length:301 Identity:157/301 - (52%)
Similarity:206/301 - (68%) Gaps:8/301 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IDSIISRLLEVRGARPGKNVQL-SEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDL 70
            :.|:|.||   :...||:..|| .|.|:..||.::||.|....:.|::|||:|||||||||:.||
 Worm    30 LHSVIERL---KWWSPGRCQQLFVENELIELCYRAREQFWKNKVKLDIEAPVKICGDIHGQFEDL 91

  Fly    71 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFY 135
            :.|||..|:|.|..|||||||||||..|:|.|.||..::|...:..||||||||...:|..||||
 Worm    92 MALFELNGWPEEHKYLFLGDYVDRGPFSIEVITLLFTFQILMPDKVFLLRGNHESRPVNMQYGFY 156

  Fly   136 DECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLC 200
            .|||:|||:.|:..|...|||:|:.|:|.:||.|.|||:|.||..:.|:.:|.||.|:||.|::.
 Worm   157 LECKKRYSVALYDAFQLAFNCMPLCAVVSKKIICMHGGISEDLIDLTQLEKIDRPFDIPDIGVIS 221

  Fly   201 DLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLF 265
            ||.|:|||:...|:.::.||...:||...|.||||.|..||:.||||||.|||||||.|.|||:|
 Worm   222 DLTWADPDEKVFGYADSPRGAGRSFGPNAVKKFLQMHNLDLVVRAHQVVMDGYEFFADRQLVTVF 286

  Fly   266 SAPNYCGEFDNAGAMMSVDDTLMCSFQILKP----ADKRKK 302
            |||:|||:||||.|:|:|||.|:|:|.|.:|    .|.:||
 Worm   287 SAPSYCGQFDNAAAVMNVDDKLLCTFTIFRPDLKVGDFKKK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 153/289 (53%)
F23B12.1NP_506574.3 PP2Ac 51..317 CDD:197547 145/265 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156385
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.