DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and R08C7.8

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_500563.2 Gene:R08C7.8 / 177208 WormBaseID:WBGene00019951 Length:362 Species:Caenorhabditis elegans


Alignment Length:274 Identity:114/274 - (41%)
Similarity:167/274 - (60%) Gaps:8/274 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVD 93
            ::.:|..:..|:.......|.:|::|.|:.|.||||||...|:|.|:..|:||:..:||||||||
 Worm    28 TDKQIYTILEKAESTLKPLPAMLQVEHPITIVGDIHGQLDALIRYFDAVGYPPKVQFLFLGDYVD 92

  Fly    94 RGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLP 158
            ||.:|.|...||..|||:|.....||||||||..:||:||||:|..|:...::|:.:.:.||.||
 Worm    93 RGAKSFEVSLLLFCYKIRYPHLVHLLRGNHECMKMNRLYGFYEELTRKRGGRMWRQYQNVFNELP 157

  Fly   159 VAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVP---DQGLLCDLLWSDPDKD---TMGWGEN 217
            :.|.|.::|.|.|||:|.:..|.|..:.:.:| :.|   |:||..||:|:||.:|   |....: 
 Worm   158 LCARVGQRILCMHGGISQNCNSWESFKALKKP-NTPLTCDEGLQVDLMWADPTQDKCNTFAMNK- 220

  Fly   218 DRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMS 282
            .|.:|..||.:.:..||:|....||.|||:|.::|:.|...:..||:||||.|||...|.||:|.
 Worm   221 QRAISVVFGQKGLDDFLKKLGLSLIVRAHEVSQEGFNFLFNKKCVTVFSAPYYCGNDTNCGAIMH 285

  Fly   283 VDDTLMCSFQILKP 296
            |.|:...||.:|:|
 Worm   286 VSDSYELSFTVLRP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 113/272 (42%)
R08C7.8NP_500563.2 PP2Ac 27..299 CDD:197547 113/272 (42%)
MPP_PPP_family 57..286 CDD:277316 102/230 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156416
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.