DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and pph-4.1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_499603.1 Gene:pph-4.1 / 176657 WormBaseID:WBGene00004085 Length:333 Species:Caenorhabditis elegans


Alignment Length:298 Identity:131/298 - (43%)
Similarity:196/298 - (65%) Gaps:9/298 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDL 70
            ::|..|.:|:...        .::|.:::.||.|:|||...:..:..:::|:.||||||||:|||
 Worm    31 DLDRHIEKLMRCE--------LIAEQDVKTLCAKAREILAEEGNVQVIDSPVTICGDIHGQFYDL 87

  Fly    71 LRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFY 135
            :.||:.||..|.:|||||||:||||..|:||..||||.|.:|.:...|:|||||...|.::||||
 Worm    88 MELFKVGGPVPNTNYLFLGDFVDRGFYSVETFLLLLALKARYPDRMMLIRGNHESRQITQVYGFY 152

  Fly   136 DECKRRY-SIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            |||.|:| :..:||..|:.|:.|.:||::|.|:||.||||||.:::|:|||.|.|..:||..|.:
 Worm   153 DECLRKYGNASVWKHCTEVFDYLSLAAVIDGKVFCVHGGLSPSISTMDQIRVIDRKQEVPHDGPM 217

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264
            ||||||||::..:|||.:.||..:.|||:....|.:.:..||||||||:|.:||::.....::|:
 Worm   218 CDLLWSDPEEGNVGWGLSPRGAGYLFGADASKTFCETNGVDLICRAHQLVMEGYKWHFNEKVLTV 282

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302
            :||||||....|..|::.:|:.|...|.|.:.|.:..:
 Worm   283 WSAPNYCYRCGNVAAILELDENLNKEFTIFEAAPQENR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 130/290 (45%)
pph-4.1NP_499603.1 PTZ00239 31..333 CDD:173488 131/298 (44%)
MPP_PP2A_PP4_PP6 31..316 CDD:277360 130/292 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.