DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and R13A5.11

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001299879.1 Gene:R13A5.11 / 176075 WormBaseID:WBGene00020053 Length:459 Species:Caenorhabditis elegans


Alignment Length:277 Identity:119/277 - (42%)
Similarity:172/277 - (62%) Gaps:3/277 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGD 90
            :|.::.|...:..:::.||.|:..|::::.|..:.||:|||:.||:.:|...|.|||:.|:|.||
 Worm   162 IQYTKEEFENVIYEAQTIFSSEKALVDIDPPCVVVGDLHGQFNDLINMFILLGRPPETVYVFTGD 226

  Fly    91 YVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKR---RYSIKLWKTFTD 152
            |||||..|||.|.||..|||.|.||..|||||||.|.:|:.||||:||..   :...::|..|..
 Worm   227 YVDRGMMSLECIMLLFTYKICYPENIVLLRGNHEIARVNKKYGFYEECVTSIPKCGEEIWALFQR 291

  Fly   153 CFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGEN 217
            |||.||::|::..||.|.||||||.||.::::|...:|...|.:|::.|:||:|||.....|..:
 Worm   292 CFNNLPISALIATKILCMHGGLSPALTCLDELRNHPKPIRNPFRGIVNDMLWADPDPSVFEWKAS 356

  Fly   218 DRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMS 282
            .||..||||..|:....::...:||.||||:..|||...:.|.|:|:||||.||..:.|||.::.
 Worm   357 SRGSGFTFGTNVIDDVCKRLGVELIIRAHQMCFDGYWVLSGRKLITIFSAPMYCNFYKNAGCVLK 421

  Fly   283 VDDTLMCSFQILKPADK 299
            ||:||........||.:
 Worm   422 VDETLGIQMIAFVPASE 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 117/272 (43%)
R13A5.11NP_001299879.1 PP2Ac 164..437 CDD:197547 117/272 (43%)
MPP_PPP_family 194..422 CDD:277316 106/227 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.