DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and C23G10.1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001367544.1 Gene:C23G10.1 / 175880 WormBaseID:WBGene00016010 Length:454 Species:Caenorhabditis elegans


Alignment Length:299 Identity:136/299 - (45%)
Similarity:184/299 - (61%) Gaps:9/299 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            |..:..|..||..:|....:.:.:.  .:..:|   ::||..|..::|::.|::||||:||||.|
 Worm   144 MFAEHFIKTLLACKGMTKIRTMDIF--RLIHIC---KKIFTVQKSMVEIDGPVRICGDLHGQYPD 203

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
            |:|||..|||||:|||||||||||||..:||.|.|.||||.:|..||.:||||||...||..|||
 Worm   204 LIRLFAQGGFPPDSNYLFLGDYVDRGSFNLEVILLCLAYKARYPNNFMMLRGNHEVIHINEKYGF 268

  Fly   135 YDEC---KRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQ 196
            .||.   |..|..:|:..|.:..:.:|:.|:|..:|.|.|||||..:.|::.:|.:.||....|:
 Worm   269 KDEVFNRKGEYHDELYPEFNEMMDMMPLVALVGGRILCMHGGLSQHIKSLDDLRNLRRPFHSEDE 333

  Fly   197 GLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRML 261
            .|..|::||||.| ..||..|.||.|..||...|.:..:..:.|||.|.||||:|||||||.:.|
 Worm   334 CLENDIMWSDPAK-VSGWTANPRGASVQFGENEVKEMCKLLDIDLIVRGHQVVQDGYEFFAGKKL 397

  Fly   262 VTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR 300
            ||:||||:|...|.|:.|:..|...|..||::|||.|.|
 Worm   398 VTVFSAPHYMQSFTNSAAVCKVSAGLEVSFEVLKPEDIR 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 131/292 (45%)
C23G10.1NP_001367544.1 PP2Ac 162..432 CDD:197547 127/275 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.