DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and pef-1

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_741091.1 Gene:pef-1 / 175257 WormBaseID:WBGene00003969 Length:707 Species:Caenorhabditis elegans


Alignment Length:270 Identity:95/270 - (35%)
Similarity:145/270 - (53%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KSREIFLSQP----ILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQS 98
            ::|:||.:.|    |...:...:.||||:||::.||..:....|:|...| |:|.||:||||.||
 Worm   229 EARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQS 293

  Fly    99 LETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY---SIKLWKTFTDCFNCLPVA 160
            :|.:|:|.|..|....:.:|.|||||...:|..|||..|...:|   |..:.:...|.|:.||:|
 Worm   294 IEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIA 358

  Fly   161 AIVDEKIFCCHGGLS--PDLTSMEQIRR-----IMRP--------------TDVPDQGLLCDLLW 204
            .|:|..||..|||:|  .:::.:::|.|     ::||              .:|.:...:.|::|
 Worm   359 TIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMW 423

  Fly   205 SDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPN 269
            |||.::...|....||....|||::.|.||:||.|.|:.|:|:...:||||......:|:|||.|
 Worm   424 SDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASN 488

  Fly   270 YCGEFDNAGA 279
            |.....|.||
 Worm   489 YYETGSNRGA 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 95/270 (35%)
pef-1NP_741091.1 MPP_RdgC 199..515 CDD:277364 95/270 (35%)
PP2Ac 218..514 CDD:197547 95/270 (35%)
EFh 634..699 CDD:238008
EF-hand_7 634..698 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.