DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and ppp1cb

DIOPT Version :9

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001004527.2 Gene:ppp1cb / 100003223 ZFINID:ZDB-GENE-030616-609 Length:327 Species:Danio rerio


Alignment Length:298 Identity:262/298 - (87%)
Similarity:283/298 - (94%) Gaps:0/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 69
            :|:||:|||||||||.||||.||::|.|:||||:|||||||||||||||||||||||||||||.|
Zfish     6 LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD 70

  Fly    70 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGF 134
            |||||||||||||:|.|||||||||||||||||||||||||||.|||||||||||||||||||||
Zfish    71 LLRLFEYGGFPPEANNLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 135

  Fly   135 YDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLL 199
            |||||||::|||||||||||||||:|||:|||||||||||||||.||||||||||||||||.|||
Zfish   136 YDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 200

  Fly   200 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTL 264
            |||||||||||..|||||||||||||||:||:|||.:|:.||||||||||||||||||||.||||
Zfish   201 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 265

  Fly   265 FSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRKK 302
            ||||||||||||||.|||||::||||||||||::|:.|
Zfish   266 FSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 258/289 (89%)
ppp1cbNP_001004527.2 PTZ00480 3..300 CDD:185658 260/293 (89%)
MPP_PP1_PPKL 7..297 CDD:277359 258/289 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.