DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf24 and Rnf24

DIOPT Version :9

Sequence 1:XP_005160122.1 Gene:rnf24 / 492480 ZFINID:ZDB-GENE-041114-40 Length:157 Species:Danio rerio
Sequence 2:NP_848722.1 Gene:Rnf24 / 51902 MGIID:1261771 Length:148 Species:Mus musculus


Alignment Length:149 Identity:124/149 - (83%)
Similarity:134/149 - (89%) Gaps:1/149 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 MTSDLQHYSFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKELYAYKQVIQ 73
            |:||..||:|||||||||||||||||||||||:|||||||||||||||||||||||.|||||||.
Mouse     1 MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAYKQVIL 65

Zfish    74 KEKVKELNLHEICAVCLEEFKQKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQQQS 138
            |||||||||||:||||||:||.:|||||||||||||||||:|||||||||||||||||||||..|
Mouse    66 KEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNMPVLQLAQLHS 130

Zfish   139 MSEPIAPTQQHLPGVENLV 157
            ..:. .|.|:.|||.||:|
Mouse   131 KQDR-GPPQEPLPGAENIV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf24XP_005160122.1 zf-RING_2 84..126 CDD:290367 36/41 (88%)
Rnf24NP_848722.1 RING-H2_RNF24_like 76..122 CDD:319383 40/45 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C193129219
Domainoid 1 1.000 147 1.000 Domainoid score I18054
eggNOG 1 0.900 - - E33208_3BMCY
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5223
Inparanoid 1 1.050 265 1.000 Inparanoid score I9976
OMA 1 1.010 - - QHG44968
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001067
OrthoInspector 1 1.000 - - oto57581
orthoMCL 1 0.900 - - OOG6_113059
Panther 1 1.100 - - LDO PTHR22763
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10542
SonicParanoid 1 1.000 - - X2289
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1616.330

Return to query results.
Submit another query.