DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf24 and Rnf122

DIOPT Version :9

Sequence 1:XP_005160122.1 Gene:rnf24 / 492480 ZFINID:ZDB-GENE-041114-40 Length:157 Species:Danio rerio
Sequence 2:XP_038951021.1 Gene:Rnf122 / 502091 RGDID:1561238 Length:183 Species:Rattus norvegicus


Alignment Length:116 Identity:76/116 - (65%)
Similarity:94/116 - (81%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


Zfish    17 SFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLI-RLRHQAHKELYAYKQVIQKEKVKEL 80
            |..||.|.||:||||||:|:|||.||||:|||:||||.| :||:||..|.|.||:|:.|...|:|
  Rat    50 SCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKL 114

Zfish    81 NLH-EICAVCLEEFKQKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPV 130
            .|: :.||||||:||.|||||:.||:||||||||:||||||.|||:||.|:
  Rat   115 QLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf24XP_005160122.1 zf-RING_2 84..126 CDD:290367 32/41 (78%)
Rnf122XP_038951021.1 RING-H2_RNF24_like 119..165 CDD:319383 34/45 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I28475
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG44968
OrthoDB 1 1.010 - - D1625209at2759
OrthoFinder 1 1.000 - - FOG0001067
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2289
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.