DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf24 and C18B12.4

DIOPT Version :9

Sequence 1:XP_005160122.1 Gene:rnf24 / 492480 ZFINID:ZDB-GENE-041114-40 Length:157 Species:Danio rerio
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:168 Identity:47/168 - (27%)
Similarity:80/168 - (47%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


Zfish     2 IYLPVLSMT-----------SDLQHYSFRMP-NIGFQNL-----PLNIYIVVFGTAIFVFILSLL 49
            :.:|||.::           ||...|..|:. :.|:..|     |. :.::||..|:|:..|.:.
 Worm   149 VNIPVLMISHACKEEIAKKFSDTAGYRLRVRIDPGYYELFRYLIPF-LVVIVFCFALFLITLCVR 212

Zfish    50 FCCYLIRLRHQAHKELYAYKQVIQKEKVKELNL---HEICAVCLEEFKQKDELGICPCKHAFHRK 111
            .|..    |.:.:|...: |:.::|..||:..|   .:.||:|||.|...::|...||:|.||..
 Worm   213 GCVE----RRKLNKRRLS-KRNLKKIPVKKYRLGDDPDTCAICLESFASGEKLRHLPCRHVFHCN 272

Zfish   112 CLIKWL-EVRKVCPLCNMPVLQLAQQQSMSEPIAPTQQ 148
            |:..|| :.||:||||...:...:..:..:..:|.|.|
 Worm   273 CIDVWLTQTRKICPLCKRKIGTDSDSECSTNDLASTSQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf24XP_005160122.1 zf-RING_2 84..126 CDD:290367 19/42 (45%)
C18B12.4NP_510498.1 PA <74..176 CDD:333703 6/26 (23%)
HRD1 <223..>335 CDD:227568 29/89 (33%)
RING-H2_RNF103 246..291 CDD:319387 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.