DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rnf24 and rnf24

DIOPT Version :9

Sequence 1:XP_005160122.1 Gene:rnf24 / 492480 ZFINID:ZDB-GENE-041114-40 Length:157 Species:Danio rerio
Sequence 2:XP_031751089.1 Gene:rnf24 / 100485988 XenbaseID:XB-GENE-944529 Length:158 Species:Xenopus tropicalis


Alignment Length:149 Identity:130/149 - (87%)
Similarity:133/149 - (89%) Gaps:1/149 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 MTSDLQHYSFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKELYAYKQVIQ 73
            |:.|.||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||.
 Frog    11 MSPDFQHYSFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQARKELYAYKQVIL 75

Zfish    74 KEKVKELNLHEICAVCLEEFKQKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQQQS 138
            |||||||||:|||||||||||.||||||||||||||||||||||||||||||||||||||||..|
 Frog    76 KEKVKELNLYEICAVCLEEFKPKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHS 140

Zfish   139 MSEPIAPTQQHLPGVENLV 157
            ..|. .|.|..|||.||:|
 Frog   141 NQEH-GPPQGPLPGAENIV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rnf24XP_005160122.1 zf-RING_2 84..126 CDD:290367 40/41 (98%)
rnf24XP_031751089.1 RING-H2_RNF24_like 86..132 CDD:319383 44/45 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I18536
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5223
Inparanoid 1 1.050 266 1.000 Inparanoid score I10054
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625209at2759
OrthoFinder 1 1.000 - - FOG0001067
OrthoInspector 1 1.000 - - oto80458
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2289
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.