DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rec and MCM3

DIOPT Version :9

Sequence 1:NP_001262615.1 Gene:rec / 49241 FlyBaseID:FBgn0003227 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001353298.1 Gene:MCM3 / 4172 HGNCID:6945 Length:833 Species:Homo sapiens


Alignment Length:683 Identity:154/683 - (22%)
Similarity:277/683 - (40%) Gaps:155/683 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DFVPVESIEGISHSRVDTLFS--------------------------------------IRGFVS 265
            ||:..|..:||..|:|..|.|                                      ::.||:
Human    21 DFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVA 85

  Fly   266 NVGEPSYSLTWQAFRCSRCQMEIAMRQRGTF-----QPRPYQCKRSECVARDEFVPLRSS----- 320
            :: :.:|:..::         |..:...|:|     .||........||...|.:..:.|     
Human    86 SI-DATYAKQYE---------EFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPK 140

  Fly   321 --------PYTRLSIRQ-------IIRVEESS-----------------LNLVHDFET------- 346
                    |.|:.:|.:       ::....||                 |::..|.:|       
Human   141 VVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMP 205

  Fly   347 ------SMPAEMDVELRHDLVDAVRVGQEVVVTGILKLQELGDDTTTGDTSNQMQPYLKAVSIRD 405
                  .:|..:||.|..||||..:.|..|.|.|..:..   .....|.||...:..|.|.:::.
Human   206 EKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCL---PGKKGGYTSGTFRTVLIACNVKQ 267

  Fly   406 AS-SIKREFSERDLEAIVMIN--AEPNSFKLLVQSIAPEVYGHELPKAACLLSLLGGKGAETE-- 465
            .| ..:..||..|:..|...:  ...:.|..|.:|:||.::||:..|.|.|..||||...:.|  
Human   268 MSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENG 332

  Fly   466 -----AINVLLVGDPGIGKTKILQSCAQIAERGAHVSGKRGAQSAQQLGVTFA-----GRNKRVL 520
                 .||:||:|||.:.|:::|:.....|.|....:| ||:..   :|:|.|     ...:|.|
Human   333 SHIRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTG-RGSSG---VGLTAAVTTDQETGERRL 393

  Fly   521 QAGSLMMASGGGHCTLDDVDKLAS-KQAVLLQCLQSEEVNLPLAGAFASFPAQPSVIACANPQRG 584
            :||::::|..|..| :|:.||::. .:..:.:.::...|.:..||..|...|:.||:|.|||..|
Human   394 EAGAMVLADRGVVC-IDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYG 457

  Fly   585 QYDEGRYLLQNINISPSLLREFHLVYILLDK-PSERDMSLTAHVRALHAGARKRARIAARYALKP 648
            :||:.:..::||.:..|||..|.|::|:||: ..|:|..::.||..:|           ||....
Human   458 RYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMH-----------RYRAPG 511

  Fly   649 KMSDSMCEVSLNVPAAGKDDDTIKTEDDNDSIMQQDYD-----LDKRLEVLPEEGDLDLLPPILI 708
            :.......:...|.....||.....||..|:.:.:.:|     ..|:.|        .::....:
Human   512 EQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKE--------KMVSAAFM 568

  Fly   709 KKFLSYARQELNPVLNEDASNAVLRYFLELKGSCNLDEDV--SSQIGAGQLLAIIHLSQARARLD 771
            ||::..|: .:.|||.::::..:...:..|:...::..|.  :|.:.|..|..:|.|:.|.|:..
Human   569 KKYIHVAK-IIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAKAR 632

  Fly   772 LSHVVSPQHVRDVIALLTESITQTSLKEGSSRQ 804
            :|..|..|...:.:.|:..:..:..|::...|:
Human   633 MSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRK 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
recNP_001262615.1 RNR_PFL <117..200 CDD:299130
MCM 243..792 CDD:214631 150/665 (23%)
P-loop_NTPase 468..606 CDD:304359 45/143 (31%)
MCM3NP_001353298.1 MCM_N 19..104 CDD:317013 13/92 (14%)
MCM 109..654 CDD:214631 137/572 (24%)
Arginine finger 477..480 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 662..739 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.