DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rec and mei-218

DIOPT Version :9

Sequence 1:NP_001262615.1 Gene:rec / 49241 FlyBaseID:FBgn0003227 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001027068.1 Gene:mei-218 / 3772646 FlyBaseID:FBgn0002709 Length:1186 Species:Drosophila melanogaster


Alignment Length:192 Identity:41/192 - (21%)
Similarity:76/192 - (39%) Gaps:42/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 PYLKAVSIRDASSIKREFSERDLEAIVMINAEPNSFKLL-------------VQSIAPEVYGHEL 447
            |..:.:..|..|...:|:.:.||      |..|:|.|.|             |.:::.::....:
  Fly   795 PLERHMIFRAPSQHGQEYPKPDL------NCVPSSIKKLHHLISSQYSDYSFVYALSAQISQDCV 853

  Fly   448 P-------KAACLLSLLGGKGAETEA-INVLLVGDPGIGKTKILQSCAQIAER--GAHVSGKRGA 502
            |       |...|.|::..:..|..| |::.::....:...::|....|:|.|  |.|..|    
  Fly   854 PMDCFVYLKMILLASIVSIESDEVRAPISLCIIATDSLMANRLLNKVGQLAPRFLGPHEYG---- 914

  Fly   503 QSAQQLGVTFAGRNKRV--LQAGSLMMASGGGHCTLDDVDKLASKQAVLLQ-CLQSEEVNLP 561
                 |..||.....|.  :.|..|::|..|.:.. .|.::|:..|...|: |:::..|.:|
  Fly   915 -----LQPTFNALPTRFNWIVASPLLLAQQGVYYA-GDWNRLSKDQGCQLEKCIENGAVPVP 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
recNP_001262615.1 RNR_PFL <117..200 CDD:299130
MCM 243..792 CDD:214631 41/192 (21%)
P-loop_NTPase 468..606 CDD:304359 22/99 (22%)
mei-218NP_001027068.1 PTZ00112 122..>417 CDD:240274
MCM <1023..1116 CDD:278895
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11630
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.