DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rec and mcm3l

DIOPT Version :9

Sequence 1:NP_001262615.1 Gene:rec / 49241 FlyBaseID:FBgn0003227 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001164539.1 Gene:mcm3l / 100147915 ZFINID:ZDB-GENE-040121-2 Length:807 Species:Danio rerio


Alignment Length:490 Identity:131/490 - (26%)
Similarity:222/490 - (45%) Gaps:70/490 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 MPAEMDVELRHDLVDAVRVGQEVVVTGILKLQELGDDTTTGDTSNQMQPYLKAVSIRDAS-SIKR 411
            :|..:|:....||||.|:.|..|.:.|:.:.......   |.||...:..|.|.:::..| .|..
Zfish   211 LPRSVDIIANDDLVDRVKPGDRVQIVGVYRCLPAKQG---GFTSGTFRTILLANNVKLMSKEIVP 272

  Fly   412 EFSERDLEAIVMINAEPNS---FKLLVQSIAPEVYGHELPKAACLLSLLGGKGAETE-------A 466
            .||..|:..|... .:.:|   |:.|.:|:||.::|||..|.|.|..||||.....|       .
Zfish   273 TFSGDDVAKIKKF-CKAHSKDVFEQLSRSLAPSIHGHEYIKKAILCLLLGGNETNLENGTRIRGD 336

  Fly   467 INVLLVGDPGIGKTKILQSCAQIAERGAHVSGKRGAQSAQQLGVTFA-----GRNKRVLQAGSLM 526
            ||:||:|||.:.|:::|:.....|.|....:| ||:..   :|:|.|     ...:|.|:||:::
Zfish   337 INILLIGDPSVAKSQLLRYVLFTAPRAIPTTG-RGSSG---VGLTAAVTTDQETGERRLEAGAMV 397

  Fly   527 MASGGGHCTLDDVDKLAS-KQAVLLQCLQSEEVNLPLAGAFASFPAQPSVIACANPQRGQYDEGR 590
            :|..|..| :|:.||::. .:..:.:.::...|.:..||..|...|:.||:|.|||..|:||:.:
Zfish   398 LADRGVVC-IDEFDKMSDMDRTAIHEVMEQGRVTISKAGIQARLNARCSVLAAANPVYGRYDQYK 461

  Fly   591 YLLQNINISPSLLREFHLVYILLDK-PSERDMSLTAHVRALHAGARKRARIAARYALKPKMSDSM 654
            ..::||.:..|||..|.|::|:||: ..:.|..::.||..:|   |.||...|.....|      
Zfish   462 TPMENIGLQDSLLSRFDLLFIVLDQMDPDSDKEISEHVLRMH---RYRAPGEAEGTAMP------ 517

  Fly   655 CEVSLNVPAAGKDDDTIKTEDDN-DSIMQQDYDL------------DKRLEVLPEEGDLDLLPPI 706
                     .|...|...|||.| ....:|:..:            .||.:::..|         
Zfish   518 ---------LGSTVDVFATEDPNITEASEQELQIYEKKDNVLHGHRKKREKIVTME--------- 564

  Fly   707 LIKKFLSYARQELNPVLNEDASNAVLRYFLELKG--SCNLDEDVSSQIGAGQLLAIIHLSQARAR 769
            .|:|::..|:. :.|||.::||:.:...:..|:.  ..|.|...:..:.|..|..:|.||.|.|:
Zfish   565 FIRKYIHVAKL-VKPVLTQEASDYIAEEYSRLRSHDQVNSDSARTMPVTARALETMIRLSTAHAK 628

  Fly   770 LDLSHVVSPQHVRDVIALLTESITQTSLKEGSSRQ 804
            ..:|..|........:.|:..:..:..|::...|:
Zfish   629 ARMSKTVDLADAEAALELMQFAYFKKILEKVKKRK 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
recNP_001262615.1 RNR_PFL <117..200 CDD:299130
MCM 243..792 CDD:214631 129/476 (27%)
P-loop_NTPase 468..606 CDD:304359 45/143 (31%)
mcm3lNP_001164539.1 MCM_N 29..127 CDD:291233
MCM 107..652 CDD:214631 129/477 (27%)
P-loop_NTPase 338..477 CDD:304359 45/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.