DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fosb and kay

DIOPT Version :9

Sequence 1:XP_005173698.1 Gene:fosb / 492346 ZFINID:ZDB-GENE-041114-181 Length:411 Species:Danio rerio
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:441 Identity:106/441 - (24%)
Similarity:161/441 - (36%) Gaps:138/441 - (31%)


- Green bases have known domain annotations that are detailed below.


Zfish    31 VGVSASLGSIGDMFQGFPGDPDTGSRGSSSPSLESQYLSSV--ESFGSPPTTSAPQECVTATGGV 93
            :|:...:.|: .:.|.|  |...| :||.|....:.|..:.  |...:..|:||..:..:...|.
  Fly   297 MGIPTGVSSL-PLQQTF--DLSLG-QGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGH 357

Zfish    94 GVGGGSTGAGVDMPSSFVPTVTAITTSQDLQWMVQPTLISSVAPGQSGTGSSTMTQPVALDPYDL 158
            .:.|...|.||   ::|...:.|:::|:                |.:..|||...          
  Fly   358 IMAGSVNGGGV---NNFSNVLAAVSSSR----------------GSASVGSSNAN---------- 393

Zfish   159 PGPSFSSGGFTPPSSDTPGPVRQSRSRRRARDETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT 223
                         :|:|  |.|:...||..|...:|||||:||.|||||||.|||:||.||.:.|
  Fly   394 -------------TSNT--PARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQT 443

Zfish   224 DRLQSETDILEEEKAELEAEISELQKEKERLEFVLVAHQPGCKLPYQDQPPAPLPQTSPQAPSVS 288
            :.|..|.:.||:....:..||..|...|.:||::|..|:..|:....|.              :|
  Fly   444 NELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDM--------------LS 494

Zfish   289 VV---GLTVKEDSFYLPPA-----------YSSHHHHHVPVS-------------------QPTQ 320
            ||   ||        :.||           .||||:|:...|                   .|..
  Fly   495 VVTCNGL--------IAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLD 551

Zfish   321 TQPAPAQQQQGM-MQEVAFSSSFYGPGQPAPDGP---------------------CLVADGGGNP 363
            .:||.......| :::.....:.........|||                     .|...|.   
  Fly   552 LKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILTPTGA--- 613

Zfish   364 DAGSYIPSYTSS----FVFTYPEGACGASANQRTSSSDQSSDSLNSPSLLA 410
            .:||.....||:    |...:|..:.|:|.|...|    ..:::|||:|.|
  Fly   614 SSGSLQTPITSTAPGGFGSAFPVTSNGSSINNINS----IGNNMNSPTLNA 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fosbXP_005173698.1 bZIP_Fos 208..261 CDD:269869 21/52 (40%)
coiled coil 208..260 CDD:269869 21/51 (41%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 28/60 (47%)
coiled coil 421..480 CDD:269869 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10618
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24837
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.