DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod(mdg4) and bab2

DIOPT Version :9

Sequence 1:NP_788698.1 Gene:mod(mdg4) / 49228 FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_523879.2 Gene:bab2 / 44254 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster


Alignment Length:483 Identity:108/483 - (22%)
Similarity:176/483 - (36%) Gaps:147/483 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDEQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKAHRLVLSVCSPFFRKMFTQMPSN 67
            :.:||.|.|||:.:||:..|.|.|.....|||:|:.||..:|||::|||.|||:|:.:|...|..
  Fly   194 EGQQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYDNPCQ 258

  Fly    68 THAIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAFISTAESLQIKGLT--------------- 117
             |.|:.:.:||.|.||.|::|||.||:||.||.:...:..||:|:|:||.               
  Fly   259 -HPIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAEVSAGRGEGGASALP 322

  Fly   118 ----------------------DNDPAPQPPQESSPPPAAPH----VQQQQ----------IPAQ 146
                                  |.|..|....::..|...|.    :.|:|          .|:.
  Fly   323 MSAFDDEDEEEELASATAILQQDGDADPDEEMKAKRPRLLPEGVLDLNQRQRKRSRDGSYATPSP 387

  Fly   147 RVQRQQPRASARYKIETVDDGLGDEKQSTTQIVIQTTAAPQATIVQQQQPQQAAQQIQSQQLQTG 211
            .:|..:...|.|       ...|...||.:|.:..||    :|||:........|.::      |
  Fly   388 SLQGGESEISER-------GSSGTPGQSQSQPLAMTT----STIVRNPFASPNPQTLE------G 435

  Fly   212 TTTTATLVSTNKRSAQRSSLTPASSSAGVKRSKTSTSANVMDPLDSTTETGATTTAQLVPQQITV 276
            ..:....|:..::|       ||.::.|  .|..::.|.:..|     ..|....:.|.|.    
  Fly   436 RNSAMNAVANQRKS-------PAPTATG--HSNGNSGAAMHSP-----PGGVAVQSALPPH---- 482

  Fly   277 QTSVVSAAEAKLHQQSPQQVRQEEAEYIDLPMELPTKSEPDYSEDH-----------GDAAGDAE 330
            ..::|....:.:|..:.|...|.:                 .:..|           |..|..|.
  Fly   483 MAAIVPPPPSAMHHHAQQLAAQHQ-----------------LAHSHAMASALAAAAAGAGAAGAG 530

  Fly   331 GTYVEDDTYGDMRYDDSYFTENEDAGNQTAANTSGGGVTATTSKAVV-------------KQQSQ 382
            |.                   ...:|:..:|.|.|.||..:.:.|.|             .:..:
  Fly   531 GA-------------------GSGSGSGASAPTGGTGVAGSGAGAAVGSHHDDMEIKPEIAEMIR 576

  Fly   383 NYSESSFVDTSGDQGNTEAQAATSASAT 410
            ....:..:::.|..|...|.||.:.:|:
  Fly   577 EEERAKMIESGGHGGWMGAAAAATGAAS 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mod(mdg4)NP_788698.1 BTB 22..118 CDD:279045 44/132 (33%)
BTB 33..118 CDD:197585 40/121 (33%)
FLYWCH 452..512 CDD:282369
bab2NP_523879.2 BTB 213..309 CDD:279045 44/96 (46%)
BTB 224..309 CDD:197585 40/85 (47%)
HTH_psq 645..690 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9675
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.