DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod(mdg4) and nhr-45

DIOPT Version :9

Sequence 1:NP_788698.1 Gene:mod(mdg4) / 49228 FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_508797.3 Gene:nhr-45 / 180738 WormBaseID:WBGene00003635 Length:525 Species:Caenorhabditis elegans


Alignment Length:313 Identity:65/313 - (20%)
Similarity:101/313 - (32%) Gaps:95/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CSPFFRKMFTQMPSNTHAIVFLNNVSHSALKD--------------LIQFMYCGEVNVKQDALPA 103
            |:.|||:..|.            |:.:....|              ..::..|..|.:::|.|.:
 Worm    23 CAAFFRRTLTM------------NLRYKCRFDRKCEVSFNKRYSCRCCRYEKCVRVGMRKDNLTS 75

  Fly   104 FISTAESLQIKGLTDNDP----------APQPPQES--SPPPAAPHVQQQQIP------------ 144
            .:|.   :|.|..|:.|.          :|....||  ..||:....||.|.|            
 Worm    76 PVSV---VQNKSETEKDSSGNETDSIGHSPHSSLESYTCRPPSFEQQQQNQNPDPPLLMGNNGTF 137

  Fly   145 AQRVQRQQPRASARYKIETVDDGLGDEKQSTTQIVIQTTAAPQATIVQQQQPQQAAQQIQSQQLQ 209
            .|.|      ||..|:..:....|......|  ::.:...|...|...||.|....|....|.  
 Worm   138 VQEV------ASDAYQPNSDMHQLNFSFHRT--VIEEVGRAVMPTPPFQQPPIHIPQPFDYQY-- 192

  Fly   210 TGTTTTATLVSTNKRSAQRSSLTPASSSAGVKRSKTSTSANVMDPLDSTTETG-----ATTTAQL 269
                  ..|:||::   |.||..|:|          .|..|.: |.:...|:|     ....||.
 Worm   193 ------TDLLSTDE---QNSSAIPSS----------FTQYNQV-PQEYNNESGNQNQMFAMAAQQ 237

  Fly   270 VPQ--QITVQTSVVSAAEAKLHQQSPQQVRQEEAEYIDLPMELPTKSEPDYSE 320
            ..|  .:.||..:....:| :..|.|...    .:..|:|:.|..::...|.|
 Worm   238 ATQDLHVNVQNVLTPTIDA-MFGQPPDAF----CQLPDIPLTLCQQALLAYRE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mod(mdg4)NP_788698.1 BTB 22..118 CDD:279045 14/78 (18%)
BTB 33..118 CDD:197585 14/78 (18%)
FLYWCH 452..512 CDD:282369
nhr-45NP_508797.3 ZnF_C4 3..71 CDD:197701 9/59 (15%)
NR_LBD 305..494 CDD:132726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.788662 Normalized mean entropy S7188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.