DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mod(mdg4) and edc-3

DIOPT Version :9

Sequence 1:NP_788698.1 Gene:mod(mdg4) / 49228 FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_492328.1 Gene:edc-3 / 172653 WormBaseID:WBGene00011036 Length:566 Species:Caenorhabditis elegans


Alignment Length:316 Identity:61/316 - (19%)
Similarity:98/316 - (31%) Gaps:117/316 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 GTYVEDDTYGDMRYDDSYFTENEDAGNQTAANTSGGGVTA----TTSKAVVKQ--------QSQN 383
            |:.:..:|.....|.....|.:.:.||.|.||....|:..    |.|.:.:.:        ||..
 Worm     7 GSVISTETKDGNVYQGKLTTYDTNNGNLTMANVIKNGLPLHRCFTLSSSDISRLKVIRGATQSTQ 71

  Fly   384 YSESSFVDTSGDQGNTE------------AQAATSASATKIPPRKRGR-----PKTKVEDQTPK- 430
            .|:...|..|.:..|.:            :.:..|:||:.:|...|.|     |:...:.::|| 
 Worm    72 KSQPLPVQNSSNSVNKQRPLKKSAESTVSSTSTASSSASSVPDSSRNRSVAVSPQKSAKGRSPKK 136

  Fly   431 -PKLLEKLQAATLNEEASEPAVYASTTKGGVKLIFNGHLFKFSFRKADYSVFQCCYREHGEECKV 494
             ...:|||                                               :..|....|:
 Worm   137 FATNVEKL-----------------------------------------------FEHHSTPSKL 154

  Fly   495 RVVCDQKRV------FPYEGEHV----HFMQASDKS----------------CLPSQFMPGESG- 532
            .:...|.|.      |.:..|.:    || |:.|:.                |...|   |.|| 
 Worm   155 TLAKKQSRQSPMHNGFSHTAEEISATPHF-QSFDRQVPNPKVLSTIASNGGRCSKKQ---GPSGN 215

  Fly   533 -VISSLSPSKELLMKNTTKLEEADD---KEDEDFEE----FEIQEIDEIELDEPEK 580
             |:.:|:..|.:..:|...|.:..|   ..|.||.|    ||..|.|:...:..||
 Worm   216 PVLDALNHYKGIGGRNKNDLADPIDFDLDSDFDFAENLKLFEKDENDDQYYETVEK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mod(mdg4)NP_788698.1 BTB 22..118 CDD:279045
BTB 33..118 CDD:197585
FLYWCH 452..512 CDD:282369 6/69 (9%)
edc-3NP_492328.1 Sm_like 6..63 CDD:381907 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.788662 Normalized mean entropy S7188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.