DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and STOML1

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_004800.2 Gene:STOML1 / 9399 HGNCID:14560 Length:398 Species:Homo sapiens


Alignment Length:177 Identity:35/177 - (19%)
Similarity:73/177 - (41%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GEGTHFFIPWVQRPIIFDIRSQPRNVPVI-TGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDY 114
            |.|....:|::......|:|::..|||.. ..|||...:::...:.:| |.|.:..:.|:  :|.
Human   101 GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFR-IWDPVLSVMTV--KDL 162

  Fly   115 DERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREF 179
            :.....:....:.||::.: ...|:..::..:|.::..|:....:.:|..:|.:.          
Human   163 NTATRMTAQNAMTKALLKR-PLREIQMEKLKISDQLLLEINDVTRAWGLEVDRVE---------- 216

  Fly   180 TLAVEMKQVAQQEAEKARFVVEKAEQQKL----ASIISAEGDAEAAG 222
             ||||......|::.....:....:|..|    .|:.|..|.|.:.|
Human   217 -LAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 34/174 (20%)
STOML1NP_004800.2 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000255, ECO:0000269|PubMed:19696025 6..10
PHB 77..217 CDD:214581 23/130 (18%)
SPFH_SLP-1 94..224 CDD:259814 27/137 (20%)
SCP2 304..395 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.