DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and PHB5

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_196934.1 Gene:PHB5 / 831280 AraportID:AT5G14300 Length:249 Species:Arabidopsis thaliana


Alignment Length:271 Identity:130/271 - (47%)
Similarity:185/271 - (68%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIR 70
            |.::. :|||.|:  ..|.|.::.|:||.|||:|.||.||.|..||||||..|||||:|.|||||
plant     6 FTKVA-LGLGAAI--AAVRSTMFTVDGGQRAVMFHRFEGILEEPVGEGTHRKIPWVQKPYIFDIR 67

  Fly    71 SQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFD 135
            ::|..:...:|:||||.||:|||:::|                          |:|:|||||||:
plant    68 TKPYKINTDSGTKDLQMVNLTLRVMFR--------------------------PDVVKAVVAQFN 106

  Fly   136 AGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVV 200
            |.||:|:|..||..:.:.|..|||:|..:|||:|:|.|::|:||:||||.|||||||||:::|||
plant   107 ADELLTERPQVSALIRETLIKRAKEFNIVLDDVSITGLSYGKEFSLAVERKQVAQQEAERSKFVV 171

  Fly   201 EKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQS 265
            .||:|::.|::|.|||::|||.:::|:...||.||::|||:|||.::|..||.|..|.|||||.:
plant   172 AKADQERRAAVIRAEGESEAARVISKATAGAGMGLIKLRRVEAAREVAITLSNSPNVVYLPSGGN 236

  Fly   266 TL--LNLPSTI 274
            .|  :|.||.:
plant   237 MLFAMNGPSKV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 96/193 (50%)
PHB5NP_196934.1 SPFH_prohibitin 24..192 CDD:259799 96/193 (50%)
PHB 24..158 CDD:214581 75/159 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I3435
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 291 1.000 Inparanoid score I829
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2416
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23222
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.