DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and PHB6

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001077924.1 Gene:PHB6 / 816575 AraportID:AT2G20530 Length:286 Species:Arabidopsis thaliana


Alignment Length:261 Identity:138/261 - (52%)
Similarity:186/261 - (71%) Gaps:6/261 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGVAVLGGV----VNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPR 74
            :...|:||:    ....||||:|||||::|:|..|||:.|..||||..|||.:||||:|:|::|.
plant    17 IAAVVIGGLSLYGATHTLYNVDGGHRAIVFNRLVGIKDKVYPEGTHLMIPWFERPIIYDVRAKPY 81

  Fly    75 NVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGEL 139
            .|...:||:|||.|.|.||:|.||:.||||::|..||::|.|||||||..|.|||||||::|.:|
plant    82 LVESTSGSRDLQMVKIGLRVLTRPMADQLPEVYRSLGENYRERVLPSIIHETLKAVVAQYNASQL 146

  Fly   140 ITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAE 204
            |||||.||:.:.:.||:||..|...|||:|:|.||||:|||.|:|.||||.||||:|:|:|||||
plant   147 ITQRESVSREIRKILTLRAANFHIALDDVSITGLTFGKEFTAAIEGKQVAAQEAERAKFIVEKAE 211

  Fly   205 QQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLN 269
            |.|.:::|.|||:|::|.|:.::... ....:.||:||||.:||..:|||....|| |....|||
plant   212 QDKRSAVIRAEGEAKSAQLIGQAIAN-NQAFLTLRKIEAAREIAQTISRSANKVYL-SSNDLLLN 274

  Fly   270 L 270
            |
plant   275 L 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 115/193 (60%)
PHB6NP_001077924.1 SPFH_prohibitin 34..228 CDD:259799 115/193 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I690
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.