DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and stoml1

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:274 Identity:52/274 - (18%)
Similarity:91/274 - (33%) Gaps:98/274 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IPWVQRPIIFDI-RSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKI------YTILGQDYD 115
            :|..||.:||.: |.|....|.:              :|..|:.||..::      :::......
 Frog    63 VPDYQRIVIFRLGRVQAARGPGL--------------VLLFPLIDQFQRVDMRTKAFSVPPSKVK 113

  Fly   116 ER--VLPSIAPEVLKAV---------------VAQFDAGELITQ-------------REMVSQRV 150
            .|  ||.|:..::...:               |.:..|..|:||             |..:::.:
 Frog   114 SRDGVLVSMGADIQFCICDPVLSVLSVQDLNFVTRNTAQNLMTQSLGRKYLREIQNDRARIAEHL 178

  Fly   151 SQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFV-----------VEKAE 204
            .::|..:.|.:|..::.:.           ||:|.   ..|..|.|..|           :::..
 Frog   179 KEDLNEQVKPWGLCVERVE-----------LALES---ILQTPENALIVPSVTPAVPCGGIDQLL 229

  Fly   205 QQKLASIISAEG---------DAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYL 260
            .|.||....:.|         |.....||:|......:.||.    |...  :|||     ...:
 Frog   230 MQFLALTRQSSGNDSPSLKDTDLSLKQLLSKVEASLTESLVS----EVGS--SYQL-----YVTM 283

  Fly   261 PSGQST--LLNLPS 272
            |.||.:  .|:|.|
 Frog   284 PGGQISEYFLDLKS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 37/219 (17%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581 25/159 (16%)
SPFH_SLP-1 75..205 CDD:259814 23/157 (15%)
SCP2 254..357 CDD:280250 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.