DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and stoml3a

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001092220.1 Gene:stoml3a / 571219 ZFINID:ZDB-GENE-070620-18 Length:284 Species:Danio rerio


Alignment Length:225 Identity:50/225 - (22%)
Similarity:100/225 - (44%) Gaps:27/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPV---ITGSKDLQNVNIT 91
            |:...|||||.....:.:...|.|..|.:|.....:..|:|:...|:|.   :|  ||...||:.
Zfish    57 VQEYERAVIFRLGRILDKKPKGPGIFFVLPCTDSFMKVDLRTVTFNIPAQEFLT--KDSVTVNVD 119

  Fly    92 LRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTV 156
             .::|..:.|.:..:..:...:...::|   |...|:.|:...:..||::.||.:|..:...|..
Zfish   120 -GVVYFRVFDPICSVANVSNANQATQLL---AQTTLRNVLGTKNLSELLSDREGISNSMQIALDE 180

  Fly   157 RAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAA 221
            ....:|..::.:.:      ::..|.:::::....|||        |.::..|.:|:|||:..|:
Zfish   181 ATGVWGIKVERVEI------KDVKLPIQLQRAMAAEAE--------ASREARAKVIAAEGEMNAS 231

  Fly   222 GLLAKS---FGEAGDGLVELRRIEAAEDIA 248
            ..|.::   ..|:...| :||.::....||
Zfish   232 RALKEASLVIAESPSAL-QLRYLQTLSTIA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 42/193 (22%)
stoml3aNP_001092220.1 PHB 52..204 CDD:214581 33/158 (21%)
SPFH_like 77..274 CDD:302763 44/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.