DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and stoml3b

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001017825.1 Gene:stoml3b / 550523 ZFINID:ZDB-GENE-050417-366 Length:278 Species:Danio rerio


Alignment Length:223 Identity:56/223 - (25%)
Similarity:99/223 - (44%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAVIF--DRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNITLRI 94
            |||||  .|.|..|..  |.|..|.||.....|..|:|:...::|   ::|  ||...|::. .:
Zfish    58 RAVIFRLGRITARKAK--GPGIFFIIPCTDSFIKVDLRTVSFDIPPQEILT--KDSVTVSVD-GV 117

  Fly    95 LYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAK 159
            :|..:.|.:..:..:...||..|:|   |...|:.|:...:..|:::.||.:|..:...|.....
Zfish   118 VYFRVNDPVASVANVSNADYSTRLL---AQTTLRNVLGTKNLAEVLSDREGISHSMQTTLDEATD 179

  Fly   160 QFGFILDDISLTHLTFGREFTLAVEMKQV-AQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGL 223
            .:|..::               .||:|.| ..|:.::|.....:|.::..|.:|:|||:..|:..
Zfish   180 SWGIKVE---------------RVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRA 229

  Fly   224 LAKS---FGEAGDGLVELRRIEAAEDIA 248
            |.::   ..|:...| :||.::....||
Zfish   230 LKEASLVIAESPSAL-QLRYLQTLNTIA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 48/191 (25%)
stoml3bNP_001017825.1 PHB 49..200 CDD:214581 41/164 (25%)
SPFH_like 72..270 CDD:302763 48/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.