DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and zgc:112408

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001017597.1 Gene:zgc:112408 / 550260 ZFINID:ZDB-GENE-050417-63 Length:291 Species:Danio rerio


Alignment Length:233 Identity:53/233 - (22%)
Similarity:100/233 - (42%) Gaps:44/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQ-------RPIIFDIRSQPRNVPVITGSKDLQN 87
            |:...||||| |...:.....|.|..:.||.:.       |.:.|||.:|    .|:|  ||...
Zfish    67 VQEYERAVIF-RLGRLLGGAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQ----EVLT--KDSVT 124

  Fly    88 VNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQ 152
            ..:...:.|| |.:....|..:...:|..::   ||...|:.::......:::..||.:|:::..
Zfish   125 TMVDAVVYYR-IFNPTVSITKVENANYATQM---IAQTTLRNMLGTKSLADILKDREEMSEQMEA 185

  Fly   153 ELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGD 217
            .|...:|.:|..::.:.|      ::..|...:::....|||        |.:...|.:|:|||:
Zfish   186 VLYSASKNWGIKVERVEL------KDVKLPTTLQRAMAAEAE--------ASRDARAKVIAAEGE 236

  Fly   218 -------AEAAGLLAKSFGEAGDGLVELRRIEAAEDIA 248
                   .|||.::::|     ...::||.::...:||
Zfish   237 MKASRALKEAANVMSES-----PAALQLRYMQTLTEIA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 46/204 (23%)
zgc:112408NP_001017597.1 HflC 44..290 CDD:223407 53/233 (23%)
SPFH_like 83..283 CDD:302763 46/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.