DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Phb2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster


Alignment Length:265 Identity:134/265 - (50%)
Similarity:186/265 - (70%) Gaps:8/265 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MGLGVAVLGGV------VNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIR 70
            :|:|:.||..|      |:.:||.|||||||:||.|..||:.::..||.|..|||.|.|||:|||
  Fly    21 LGIGLKVLAAVGAAAYGVSQSLYTVEGGHRAIIFSRLGGIQSDIYSEGLHVRIPWFQYPIIYDIR 85

  Fly    71 SQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFD 135
            |:||.:...|||||||.:||:||:|.||....||.::..||.||||:|||||..||||:|:|:|:
  Fly    86 SRPRKISSPTGSKDLQMINISLRVLSRPDSLNLPYLHKQLGVDYDEKVLPSICNEVLKSVIAKFN 150

  Fly   136 AGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVV 200
            |.:|||||:.||..:.:||..||:.|..||||:|||.|:||:|:|.|:|.||||||||::|.|.|
  Fly   151 ASQLITQRQQVSLLIRKELVERARDFNIILDDVSLTELSFGKEYTAAIEAKQVAQQEAQRAVFFV 215

  Fly   201 EKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQS 265
            |:|:|:|...|:.|||:||||.:|..:. :.....::||::.||:.||..::.|:...|| |..|
  Fly   216 ERAKQEKQQKIVQAEGEAEAAKMLGLAV-KQNPAYLKLRKLRAAQSIARTIASSQNKVYL-SADS 278

  Fly   266 TLLNL 270
            .:||:
  Fly   279 LMLNI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 112/193 (58%)
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 112/193 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448428
Domainoid 1 1.000 224 1.000 Domainoid score I690
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23222
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.