DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and CG14736

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:224 Identity:51/224 - (22%)
Similarity:97/224 - (43%) Gaps:39/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNV-PVITGSKDLQNVNITLR-----IL 95
            :|..|...:::.:.|.|..|.:|.:......|:|:...|| |....:||  :|.||:.     .:
  Fly    89 MIILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKD--SVTITVNAVVYYCI 151

  Fly    96 YRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQ 160
            |.||.       :|:..|..::....|:...|:.:|.......|:|.|:.:|:.:.|.:.....:
  Fly   152 YSPID-------SIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYR 209

  Fly   161 FGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLA 225
            :|..::.:.:      .:.||...:::....|||..|        :..|.||.|||:.:|    :
  Fly   210 WGVRVERVDV------MDITLPTSLERSLASEAEAVR--------EARAKIILAEGELKA----S 256

  Fly   226 KSFGEAGDGL------VELRRIEAAEDIA 248
            |:..||.|.:      ::||.::....||
  Fly   257 KALKEASDVMSENKITLQLRHLQILSSIA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 42/189 (22%)
CG14736NP_001287293.1 PHB 78..225 CDD:214581 31/150 (21%)
SPFH_like 100..305 CDD:302763 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.