DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and phb

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_989038.1 Gene:phb / 394635 XenbaseID:XB-GENE-977670 Length:272 Species:Xenopus tropicalis


Alignment Length:271 Identity:203/271 - (74%)
Similarity:243/271 - (89%) Gaps:0/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPI 65
            |||:.|..||::|||:||.|||||||||||:.||:|||||||.|::|.||||||||.|||||:||
 Frog     1 MAARLFETIGKLGLGLAVAGGVVNSALYNVDAGHQAVIFDRFRGVQETVVGEGTHFLIPWVQKPI 65

  Fly    66 IFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAV 130
            |||.||:||||||:||||||||||||||||:||:.:|||:|:|.:|:||||||||||..|:||:|
 Frog    66 IFDCRSRPRNVPVVTGSKDLQNVNITLRILFRPMGNQLPRIFTSIGEDYDERVLPSITTEILKSV 130

  Fly   131 VAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEK 195
            ||:|||||||||||:||::||::|..||..||.||||:||||||||:|||.|||.|||||||||:
 Frog   131 VARFDAGELITQRELVSRQVSEDLMERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAER 195

  Fly   196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYL 260
            |||:||||||||.|::||||||::||.|:|.|..:|||||:|||::||||||||||||:|.|.||
 Frog   196 ARFIVEKAEQQKKAAVISAEGDSKAAELIATSLADAGDGLIELRKLEAAEDIAYQLSRARNVTYL 260

  Fly   261 PSGQSTLLNLP 271
            ||||||||.||
 Frog   261 PSGQSTLLQLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 146/193 (76%)
phbNP_989038.1 SPFH_prohibitin 27..221 CDD:259799 146/193 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 279 1.000 Domainoid score I1679
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1980
Inparanoid 1 1.050 414 1.000 Inparanoid score I1800
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 1 1.000 - - FOG0003661
OrthoInspector 1 1.000 - - oto105174
Panther 1 1.100 - - LDO PTHR23222
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R920
SonicParanoid 1 1.000 - - X2109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.