DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and stoml2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_957325.1 Gene:stoml2 / 394006 ZFINID:ZDB-GENE-040426-1139 Length:355 Species:Danio rerio


Alignment Length:271 Identity:56/271 - (20%)
Similarity:104/271 - (38%) Gaps:57/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RFTGIKENVVGEGTHFFIP------WVQ--RPIIFDIRSQPRNVPVITGSKDLQNVNITL-RILY 96
            ||..|.|    .|.:|.||      :||  :.|:.|:..|        .:..|.||.:.: .:||
Zfish    59 RFHRILE----PGLNFLIPILDRIRYVQSLKEIVIDVPEQ--------SAVSLDNVTLQIDGVLY 111

  Fly    97 RPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQF 161
            ..|.|.....|   |.:..|..:..:|...:::.:.:....::..:||.::..:...:...:.::
Zfish   112 LRILDPFKASY---GVEDPEYAVTQLAQTTMRSELGKLTLDKVFRERESLNSNIVHSINQASDEW 173

  Fly   162 G-----FILDDISL--------------------THLTFG--REFTLAV----EMKQVAQQEAEK 195
            |     :.:.||.:                    |.|..|  ||..:.|    :..|:...|.||
Zfish   174 GIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESGGTRESAINVAEGRKQAQILASEGEK 238

  Fly   196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEA-GDGLVELRRIEAAEDIAYQLSRSRGVAY 259
            |. .:.||..:..|.:..||..|:|..||:::..:. |:....|...|.......:|::......
Zfish   239 AE-QINKAAGEANAVLAKAEAKAKAIRLLSEALTQQNGNAAASLSVAEQYVSAFSKLAKESNTIL 302

  Fly   260 LPSGQSTLLNL 270
            |||....:.::
Zfish   303 LPSNTGDISSM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 46/219 (21%)
stoml2NP_957325.1 PHB 45..199 CDD:214581 29/154 (19%)
SPFH_paraslipin 79..189 CDD:259811 21/120 (18%)
Band_7_C 264..326 CDD:292817 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.