Sequence 1: | NP_001163012.2 | Gene: | l(2)37Cc / 49168 | FlyBaseID: | FBgn0002031 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957325.1 | Gene: | stoml2 / 394006 | ZFINID: | ZDB-GENE-040426-1139 | Length: | 355 | Species: | Danio rerio |
Alignment Length: | 271 | Identity: | 56/271 - (20%) |
---|---|---|---|
Similarity: | 104/271 - (38%) | Gaps: | 57/271 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 RFTGIKENVVGEGTHFFIP------WVQ--RPIIFDIRSQPRNVPVITGSKDLQNVNITL-RILY 96
Fly 97 RPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQF 161
Fly 162 G-----FILDDISL--------------------THLTFG--REFTLAV----EMKQVAQQEAEK 195
Fly 196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEA-GDGLVELRRIEAAEDIAYQLSRSRGVAY 259
Fly 260 LPSGQSTLLNL 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(2)37Cc | NP_001163012.2 | SPFH_prohibitin | 27..221 | CDD:259799 | 46/219 (21%) |
stoml2 | NP_957325.1 | PHB | 45..199 | CDD:214581 | 29/154 (19%) |
SPFH_paraslipin | 79..189 | CDD:259811 | 21/120 (18%) | ||
Band_7_C | 264..326 | CDD:292817 | 9/50 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |