DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Mec2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster


Alignment Length:219 Identity:55/219 - (25%)
Similarity:98/219 - (44%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNITLRILY 96
            ||:|| |...:.....|.|..|.:|.:......|:|:...|||   ::|  ||...|.:...:.|
  Fly    97 RAIIF-RLGRLSGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLT--KDSVTVTVDAVVYY 158

  Fly    97 RPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQF 161
            | |.|.|..:..:.......|:|   |...|:.:|...:..||:|:||.::..:...|....:.:
  Fly   159 R-ISDPLYAVIQVEDYSMSTRLL---AATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPW 219

  Fly   162 GFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLL-- 224
            |.:::.:.:      ::.:|.|.|::....|||.||        ...|.:|:|||:.::|..|  
  Fly   220 GVMVERVEI------KDVSLPVSMQRAMAAEAEAAR--------DARAKVIAAEGEKKSATALKE 270

  Fly   225 AKSFGEAGDGLVELRRIEAAEDIA 248
            |.....|....::||.::....|:
  Fly   271 ASDVISASPSALQLRYLQTLSSIS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 48/188 (26%)
Mec2NP_573357.1 PHB 88..238 CDD:214581 37/153 (24%)
SPFH_like 107..314 CDD:302763 50/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.