DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and STOML2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_038470.1 Gene:STOML2 / 30968 HGNCID:14559 Length:356 Species:Homo sapiens


Alignment Length:329 Identity:67/329 - (20%)
Similarity:120/329 - (36%) Gaps:90/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIP----W-VQRPIIFDIRSQ 72
            |.|..:|.|   |.|.:.....||     .:|:..|.|    ..|:|    | |:|...|....:
Human     8 GTGALLLRG---SLLASGRAPRRA-----SSGLPRNTV----VLFVPQQEAWVVERMGRFHRILE 60

  Fly    73 PR---NVPVITGSKDLQNV----------------NITLRI---LYRPIPDQLPKIYTILGQDYD 115
            |.   .:||:...:.:|::                |:||:|   ||..|.|.....|   |.:..
Human    61 PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASY---GVEDP 122

  Fly   116 ERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFG-----FILDDISLTHLTF 175
            |..:..:|...:::.:.:....::..:||.::..:...:...|..:|     :.:.||.:..   
Human   123 EYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDIHVPP--- 184

  Fly   176 GREFTLAVEMKQVAQQEAEKARFVVEK----------AEQQKLASIISAEGD---------AEAA 221
                .:...|:...:.|..|...|:|.          ||.:|.|.|:::|.:         .||:
Human   185 ----RVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQAAGEAS 245

  Fly   222 GLLAKSFGEA--------------GDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPS 272
            .:|||:..:|              ||....|...|.......:|::......|||...   ::.|
Human   246 AVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPSNPG---DVTS 307

  Fly   273 TIAQ 276
            .:||
Human   308 MVAQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 46/244 (19%)
STOML2NP_038470.1 HflC 41..314 CDD:223407 55/284 (19%)
SPFH_paraslipin 74..184 CDD:259811 19/112 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.