DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Stoml1

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001292167.1 Gene:Stoml1 / 300748 RGDID:1559463 Length:398 Species:Rattus norvegicus


Alignment Length:300 Identity:62/300 - (20%)
Similarity:106/300 - (35%) Gaps:90/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP----------VIT 80
            ||..|....|.::| |...|: |..|.|....:|::......|:|::..|||          |::
  Rat    78 ALKIVPTYERMIVF-RLGRIR-NPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLS 140

  Fly    81 GSKDLQ--------------NVN----------ITLRILYRPIPD-QLPKIYTILGQDYDERVLP 120
            ...|:|              ::|          :|..:|.||:.: |:.|:      ...:::|.
  Rat   141 VGADVQFRIWDPVLSVMAVKDLNAATRMTAHNAMTKALLRRPLQEIQMEKL------KIGDQLLL 199

  Fly   121 SIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTL---- 181
            .| .:|.:|...:.|..||..  |.|.|.....|.|  ......|..::| |...|...::    
  Rat   200 EI-NDVTRAWGLEVDRVELAV--EAVLQPPQDSLAV--PSLDSTLQQLAL-HFLGGSMTSVGRVP 258

  Fly   182 -----AVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRI 241
                 .:||....:..|.:|....|.:.:|.:|                       :||:...:.
  Rat   259 SPGSDTLEMINEVEPPASRAGAGTEPSPKQPVA-----------------------EGLLTALQP 300

  Fly   242 EAAEDIAYQLSRSRGVAY-----LPSGQSTLLNLPSTIAQ 276
            ..:|.:..|:    |..|     ||||..::..|..|..|
  Rat   301 FLSESLVSQV----GACYQFNVLLPSGTQSIYFLDLTTGQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 48/237 (20%)
Stoml1NP_001292167.1 PHB 77..217 CDD:214581 31/147 (21%)
SPFH_SLP-1 94..224 CDD:259814 29/139 (21%)
SCP2 304..395 CDD:280250 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.