DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Stoml2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001026816.1 Gene:Stoml2 / 298203 RGDID:1308285 Length:353 Species:Rattus norvegicus


Alignment Length:316 Identity:61/316 - (19%)
Similarity:109/316 - (34%) Gaps:104/316 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRF---TGIKENVVGEGTHFFIPWVQRPIIF 67
            |:||.:.||.|.:                  .:.||.   ..:||.|:                 
  Rat    55 FHRILEPGLNVLI------------------PVLDRIRYVQSLKEIVI----------------- 84

  Fly    68 DIRSQPRNVP---VITGSKDLQNVNITL-RILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLK 128
                   |||   .:|    |.||.:.: .:||..|.|.....|   |.:..|..:..:|...::
  Rat    85 -------NVPEQSAVT----LDNVTLQIDGVLYLRIMDPYKASY---GVEDPEYAVTQLAQTTMR 135

  Fly   129 AVVAQFDAGELITQREMVSQRVSQELTVRAKQFG-----FILDDISLTHLTFGREFTLAVEMKQV 188
            :.:.:....::..:||.::..:...:...|..:|     :.:.||.:..       .:...|:..
  Rat   136 SELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIKDIHVPP-------RVKESMQMQ 193

  Fly   189 AQQEAEKARFVVEK----------AEQQKLASIISAEGD---------AEAAGLLAKSFGEA--- 231
            .:.|..|...|:|.          ||.:|.|.|:::|.:         .||:.:|||:..:|   
  Rat   194 VEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAI 258

  Fly   232 -----------GDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPSTIAQ 276
                       ||....|...|.......:|::......|||..|   ::.|.:||
  Rat   259 RILAGALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTVLLPSNPS---DVTSMVAQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 38/224 (17%)
Stoml2NP_001026816.1 HflC 38..314 CDD:223407 61/316 (19%)
SPFH_paraslipin 74..184 CDD:259811 24/140 (17%)
Band_7_C 259..321 CDD:292817 12/56 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.