DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and phb2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_588144.2 Gene:phb2 / 2538888 PomBaseID:SPCC1322.16 Length:288 Species:Schizosaccharomyces pombe


Alignment Length:260 Identity:134/260 - (51%)
Similarity:178/260 - (68%) Gaps:11/260 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNV 76
            :.||:|  |..|.::|:||:|||||:.:.|..|||..:..|||||.|||::..|.:|:|::|||:
pombe    32 LALGLA--GFAVQTSLFNVDGGHRAIKYSRIGGIKNLIYPEGTHFLIPWIETAIDYDVRAKPRNI 94

  Fly    77 PVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELIT 141
            ..:||:||||.|||..|:|.||....|||||..||.||||||||||..||||:|||||:|.:|||
pombe    95 SSLTGTKDLQMVNINCRVLSRPDVHALPKIYRTLGGDYDERVLPSIVNEVLKSVVAQFNASQLIT 159

  Fly   142 QREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQ 206
            |||.||:.|.:.|..||.:|..:|||:||||:.|..|||.|||.||:|||:|::|.|.|::|..:
pombe   160 QRERVSRLVRENLMKRAARFNILLDDVSLTHVQFSPEFTAAVEAKQIAQQDAQRATFYVDRARME 224

  Fly   207 KLASIISAEGDAEAAGLLAKSFGEA---GDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLL 268
            |...|:.|:|:..||.|:    |||   ..|.:|||::|.|.:||..||:|.....|  ..||||
pombe   225 KQGFIVRAQGEGRAAQLI----GEAIKNKPGFIELRKLETAREIANILSKSNNKVML--NASTLL 283

  Fly   269  268
            pombe   284  283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 107/193 (55%)
phb2NP_588144.2 PHB 44..205 CDD:214581 93/160 (58%)
SPFH_prohibitin 45..239 CDD:259799 107/193 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.