DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Phb

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_114039.1 Gene:Phb / 25344 RGDID:3322 Length:272 Species:Rattus norvegicus


Alignment Length:271 Identity:205/271 - (75%)
Similarity:238/271 - (87%) Gaps:0/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPI 65
            |||:.|..||:.||.:||.|||||||||||:.||||||||||.|:::.||||||||.|||||:||
  Rat     1 MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPI 65

  Fly    66 IFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAV 130
            |||.||:|||||||||||||||||||||||:||:..|||:|||.:|:||||||||||..|:||:|
  Rat    66 IFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSV 130

  Fly   131 VAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEK 195
            ||:|||||||||||:||::||.:||.||..||.||||:||||||||:|||.|||.|||||||||:
  Rat   131 VARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAER 195

  Fly   196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYL 260
            ||||||||||||.|:|||||||::||.|:|.|...|||||:|||::||||||||||||||.:.||
  Rat   196 ARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYL 260

  Fly   261 PSGQSTLLNLP 271
            |:|||.||.||
  Rat   261 PAGQSVLLQLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 151/193 (78%)
PhbNP_114039.1 SPFH_prohibitin 27..221 CDD:259799 151/193 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340526
Domainoid 1 1.000 283 1.000 Domainoid score I1567
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1980
Inparanoid 1 1.050 411 1.000 Inparanoid score I1803
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 1 1.000 - - FOG0003661
OrthoInspector 1 1.000 - - otm46246
orthoMCL 1 0.900 - - OOG6_101926
Panther 1 1.100 - - LDO PTHR23222
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2109
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.