DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and 1700071K01Rik

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001028937.1 Gene:1700071K01Rik / 237880 MGIID:3588264 Length:271 Species:Mus musculus


Alignment Length:271 Identity:203/271 - (74%)
Similarity:235/271 - (86%) Gaps:0/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPI 65
            |||:.|..||:.||.:||.||||:||||||:.||||||||||.|:::.||||||||.|||||:|:
Mouse     1 MAAKVFESIGKFGLALAVAGGVVSSALYNVDAGHRAVIFDRFHGVQDIVVGEGTHFLIPWVQKPV 65

  Fly    66 IFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAV 130
            |||.||||||:|||||||||||||||||||:||:..|||.|||.:||||||||||||..|:||:|
Mouse    66 IFDCRSQPRNIPVITGSKDLQNVNITLRILFRPVASQLPHIYTNIGQDYDERVLPSITSEILKSV 130

  Fly   131 VAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEK 195
            ||:|||||||||||:||::||.:||.||..||.||||:||||||||:|||.|||.|||||||||.
Mouse   131 VARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAET 195

  Fly   196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYL 260
            ||||||||||||:|:||||||||:||.|:|.|...|||||:|||::|||||||||||||:.|.||
Mouse   196 ARFVVEKAEQQKVAAIISAEGDAKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSQNVTYL 260

  Fly   261 PSGQSTLLNLP 271
            |.||:..|.||
Mouse   261 PVGQTVPLKLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 152/193 (79%)
1700071K01RikNP_001028937.1 PHB 26..187 CDD:214581 123/160 (77%)
SPFH_prohibitin 27..221 CDD:259799 152/193 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.