DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and STOM

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_004090.4 Gene:STOM / 2040 HGNCID:3383 Length:288 Species:Homo sapiens


Alignment Length:219 Identity:46/219 - (21%)
Similarity:95/219 - (43%) Gaps:25/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNITLRILY 96
            ||:||.....::....|.|..|.:|.....|..|:|:...::|   ::|  ||...:::...:.|
Human    62 RAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILT--KDSVTISVDGVVYY 124

  Fly    97 RPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQF 161
            | :.:....:..|...|...|:|   |...|:.|:...:..::::.||.::..:...|......:
Human   125 R-VQNATLAVANITNADSATRLL---AQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAW 185

  Fly   162 GFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLL-- 224
            |..::.:.:      ::..|.|::::....|||        |.::..|.:|:|||:..|:..|  
Human   186 GIKVERVEI------KDVKLPVQLQRAMAAEAE--------ASREARAKVIAAEGEMNASRALKE 236

  Fly   225 AKSFGEAGDGLVELRRIEAAEDIA 248
            |..........::||.::....||
Human   237 ASMVITESPAALQLRYLQTLTTIA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 39/188 (21%)
STOMNP_004090.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
SPFH_stomatin 73..274 CDD:259801 42/208 (20%)
Required for homooligomerization 265..273
Required for lipid raft association 267..269
Interaction with LANCL1. /evidence=ECO:0000269|PubMed:9512664 273..287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.