DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and sto-6

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_509943.1 Gene:sto-6 / 190619 WormBaseID:WBGene00006068 Length:298 Species:Caenorhabditis elegans


Alignment Length:224 Identity:51/224 - (22%)
Similarity:98/224 - (43%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAVIFDRFTGIKE-NVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNITLRIL 95
            ||||| |...:|. ...|.|..|.:|.:......|:|:....||   ::  |||...|.:...:.
 Worm    63 RAVIF-RLGRVKPGGARGPGLFFVVPCIDSYKKIDLRTLSFEVPPQELL--SKDAVTVAVDAVVF 124

  Fly    96 YRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQ 160
            :| |.:....:..|   :...|....:|...|:.::......|:::.|:::|.::...|......
 Worm   125 FR-ISNATISVINI---EDAARSTKLLAQTTLRNILGTKTLTEMLSDRDVISLQMQATLDETTIP 185

  Fly   161 FGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLA 225
            :|..::.:.:      ::..|..::::|...|||        |.:..:|.||:|||:..|:..||
 Worm   186 WGVKVERVEM------KDVRLPYQLQRVMAAEAE--------ATRDAMAKIIAAEGEKNASTALA 236

  Fly   226 KSFGEAGDGL------VELRRIEAAEDIA 248
                ||.|.:      ::||.::....|:
 Worm   237 ----EAADVISMSPCAIQLRYLQTLNSIS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 42/189 (22%)
sto-6NP_509943.1 PRK11029 37..>98 CDD:182913 12/35 (34%)
SPFH_like 74..275 CDD:388510 44/212 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.