DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and mec-2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001368712.1 Gene:mec-2 / 180826 WormBaseID:WBGene00003166 Length:1239 Species:Caenorhabditis elegans


Alignment Length:248 Identity:56/248 - (22%)
Similarity:100/248 - (40%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNIT 91
            |:...|||||.....:.....|.|..|.:|.:......|:|.....||   ::  |||...|.:.
 Worm   144 VQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEIL--SKDSVTVAVD 206

  Fly    92 LRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTV 156
            ..:.:| |.:....:..:   :...|....:|...|:.::......|:::.||.:|.::...|..
 Worm   207 AVVYFR-ISNATISVTNV---EDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDE 267

  Fly   157 RAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAA 221
            ..:.:|..::.:.:      ::..|.|::::....|||.||        :..|.:|.|||:.:|:
 Worm   268 ATEPWGVKVERVEV------KDVRLPVQLQRAMAAEAEAAR--------EARAKVIVAEGEQKAS 318

  Fly   222 GLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPSTI 274
            ..|.                ||||.||...|..: :.||.:..|......|||
 Worm   319 RALK----------------EAAEVIAESPSALQ-LRYLQTLNSISAEKNSTI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 41/193 (21%)
mec-2NP_001368712.1 SPFH_stomatin 160..361 CDD:259801 50/232 (22%)
PTZ00121 <571..>913 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.