DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and unc-24

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001355386.1 Gene:unc-24 / 177594 WormBaseID:WBGene00006761 Length:443 Species:Caenorhabditis elegans


Alignment Length:244 Identity:44/244 - (18%)
Similarity:85/244 - (34%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVP---VITGSKDLQNVNITLRILYRPIPDQLPK 105
            |..:...|.|....||.:.......:.....|||   :||..:.|..:..|   ::..|.|.:..
 Worm   146 GRAQKTRGPGITLVIPCIDTTHKVTMSITAFNVPPLQIITTDRGLVELGAT---VFLKIRDPIAA 207

  Fly   106 IYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRV-SQELTVRAKQFGFILDDIS 169
            :..:..::...|.|                 ...:..|.:..:|: ..||.....|||..:.|:.
 Worm   208 VCGVQDRNASVRTL-----------------ANTMLYRYISKKRICDDELGSFTCQFGVEITDVE 255

  Fly   170 LTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIIS-AEGDA-----EAAGLLAKSF 228
            ::.:.                        :|::.|...::::.| |:.||     :..|.:.:.|
 Worm   256 ISDVK------------------------IVKEGENMGMSALSSVAKSDAGQQLWQVIGPVFEDF 296

  Fly   229 GEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPS----GQST-LLNLPS 272
            .:..          |||:.|.:.:....::.:||    |.|| ..|:||
 Worm   297 AKEC----------AAEEKAKENAPLVDLSDVPSTSAAGTSTDTPNIPS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 30/186 (16%)
unc-24NP_001355386.1 SPFH_like 146..263 CDD:388510 24/160 (15%)
SCP2 338..437 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.