DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and stl-1

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001251105.1 Gene:stl-1 / 172777 WormBaseID:WBGene00006061 Length:324 Species:Caenorhabditis elegans


Alignment Length:228 Identity:52/228 - (22%)
Similarity:100/228 - (43%) Gaps:35/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VVGEGTHFFIP------WVQ--RPIIFDIRSQPRNVPVITGSKDLQNVNITL-RILYRPIPDQLP 104
            ::..|.:|.:|      :||  |.|..:|..|        |:..:.||.:.| .:||..:.|...
 Worm    58 ILEPGLNFLLPIIDKIKFVQNLREIAIEIPEQ--------GAITIDNVQLRLDGVLYLRVFDPYK 114

  Fly   105 KIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDIS 169
            ..|   |.|..|..:..:|...:::.|.:.:...:..:||::::.:...:...:..:|.......
 Worm   115 ASY---GVDDPEFAVTQLAQTTMRSEVGKINLDTVFKERELLNENIVFAINKASAPWGIQCMRYE 176

  Fly   170 LTHLTFGREFTLAVEMKQVAQQEAE-KARFVVEKAEQQKLASIISAEGDAEAAGLLAKSF----- 228
            :..:....:...|::|    |.||| |.|..:.::|..:.|:|..||||.::|.|.:::.     
 Worm   177 IRDMQMPSKIQEAMQM----QVEAERKKRAAILESEGIREAAINRAEGDKKSAILASEAVQAERI 237

  Fly   229 ----GEAGDGLVELR-RIEAAEDIAYQLSRSRG 256
                |||...:::.. |.:|.|.||..|.:..|
 Worm   238 NVAKGEAEAVILKAESRAKAIERIALALEKDGG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 40/181 (22%)
stl-1NP_001251105.1 HflC 41..298 CDD:223407 52/228 (23%)
SPFH_paraslipin 75..184 CDD:259811 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.