DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and phb-1

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_490929.1 Gene:phb-1 / 171768 WormBaseID:WBGene00004014 Length:275 Species:Caenorhabditis elegans


Alignment Length:271 Identity:188/271 - (69%)
Similarity:225/271 - (83%) Gaps:0/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPII 66
            |.:...|:|.:|:|:::.||:..:|||||:||.||||||||:|:|..||||||||.|||||:|||
 Worm     5 AQKLLGRLGTVGVGLSIAGGIAQTALYNVDGGQRAVIFDRFSGVKNEVVGEGTHFLIPWVQKPII 69

  Fly    67 FDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVV 131
            |||||.||.|..|||||||||||||||||:||.||:||.||..:|.||.|||||||..|||||||
 Worm    70 FDIRSTPRAVTTITGSKDLQNVNITLRILHRPSPDRLPNIYLNIGLDYAERVLPSITNEVLKAVV 134

  Fly   132 AQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKA 196
            |||||.|:|||||:||||.|..|..||.|||.:||||::|||.||||||.|||||||||||||||
 Worm   135 AQFDAHEMITQREVVSQRASVALRERAAQFGLLLDDIAITHLNFGREFTEAVEMKQVAQQEAEKA 199

  Fly   197 RFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLP 261
            |::||||||.|:|::.:|||||:||.||||:|..|||||||||:|||||:||.::::::.|.|||
 Worm   200 RYLVEKAEQMKIAAVTTAEGDAQAAKLLAKAFASAGDGLVELRKIEAAEEIAERMAKNKNVTYLP 264

  Fly   262 SGQSTLLNLPS 272
            ..|.|||||.|
 Worm   265 GNQQTLLNLQS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 146/193 (76%)
phb-1NP_490929.1 PHB 29..190 CDD:214581 122/160 (76%)
SPFH_prohibitin 30..220 CDD:259799 143/189 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159083
Domainoid 1 1.000 264 1.000 Domainoid score I1015
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1980
Inparanoid 1 1.050 374 1.000 Inparanoid score I1212
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 1 1.000 - - FOG0003661
OrthoInspector 1 1.000 - - oto20589
orthoMCL 1 0.900 - - OOG6_101926
Panther 1 1.100 - - LDO PTHR23222
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R920
SonicParanoid 1 1.000 - - X2109
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.