DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Stom

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_038543.1 Gene:Stom / 13830 MGIID:95403 Length:284 Species:Mus musculus


Alignment Length:253 Identity:52/253 - (20%)
Similarity:104/253 - (41%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPI 65
            :||.||..|....:.:.:...:|...       .|.:||.....::....|.|..|.:|.....|
Mouse    35 VAASFFFVIITFPISIWICIKIVKEY-------ERVIIFRLGRILQGGAKGPGLFFILPCTDSLI 92

  Fly    66 IFDIRSQPRNVP---VITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVL 127
            ..|:|:...::|   |:|  ||...:::...:.|| :.:....:..|...|...|:|   |...|
Mouse    93 KVDMRTISFDIPPQEVLT--KDSVTISVDGVVYYR-VQNATLAVANITNADSATRLL---AQTTL 151

  Fly   128 KAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQE 192
            :..:...:..::::.||.::..:...|......:|..::.:.:      ::..|.|::::....|
Mouse   152 RNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEI------KDVKLPVQLQRAMAAE 210

  Fly   193 AEKARFVVEKAEQQKLASIISAEGDAEAAGLL--AKSFGEAGDGLVELRRIEAAEDIA 248
            ||.||        :..|.:|:|||:..|:..|  |..........::||.::....||
Mouse   211 AEAAR--------EARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 39/196 (20%)
StomNP_038543.1 PHB 53..204 CDD:214581 30/169 (18%)
SPFH_stomatin 73..274 CDD:259801 43/208 (21%)
Required for homooligomerization. /evidence=ECO:0000250 265..273
Required for lipid raft association. /evidence=ECO:0000250 267..269
Interaction with LANCL1. /evidence=ECO:0000250 273..284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.