DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Phb2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_031557.2 Gene:Phb2 / 12034 MGIID:102520 Length:299 Species:Mus musculus


Alignment Length:270 Identity:135/270 - (50%)
Similarity:193/270 - (71%) Gaps:11/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GQMGLGVAV-----LGGV---VNSALYNVEGGHRAVIFDRFTGIKEN-VVGEGTHFFIPWVQRPI 65
            |..|:|.|:     .|.|   |..:::.|||||||:.|:|..|:::: ::.||.||.|||.|.||
Mouse    15 GPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPI 79

  Fly    66 IFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAV 130
            |:|||::||.:...|||||||.|||:||:|.||...:||.:|..||.||:|||||||..||||:|
Mouse    80 IYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSV 144

  Fly   131 VAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEK 195
            ||:|:|.:|||||..||..:.:|||.|||.|..||||:::|.|:|.||:|.|||.||||||||::
Mouse   145 VAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQR 209

  Fly   196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYL 260
            |:|:||||:|::...|:.|||:||||.:|.::..: ..|.::||:|.||::|:..::.|:...||
Mouse   210 AQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSK-NPGYIKLRKIRAAQNISKTIATSQNRIYL 273

  Fly   261 PSGQSTLLNL 270
             :..:.:|||
Mouse   274 -TADNLVLNL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 112/194 (58%)
Phb2NP_031557.2 Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 19..49 10/29 (34%)
SPFH_prohibitin 40..235 CDD:259799 112/194 (58%)
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 150..174 13/23 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.