DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)37Cc and Phb2

DIOPT Version :9

Sequence 1:NP_001163012.2 Gene:l(2)37Cc / 49168 FlyBaseID:FBgn0002031 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001013053.1 Gene:Phb2 / 114766 RGDID:620203 Length:299 Species:Rattus norvegicus


Alignment Length:270 Identity:135/270 - (50%)
Similarity:193/270 - (71%) Gaps:11/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GQMGLGVAV-----LGGV---VNSALYNVEGGHRAVIFDRFTGIKEN-VVGEGTHFFIPWVQRPI 65
            |..|:|.|:     .|.|   |..:::.|||||||:.|:|..|:::: ::.||.||.|||.|.||
  Rat    15 GPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPI 79

  Fly    66 IFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAV 130
            |:|||::||.:...|||||||.|||:||:|.||...:||.:|..||.||:|||||||..||||:|
  Rat    80 IYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSV 144

  Fly   131 VAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEK 195
            ||:|:|.:|||||..||..:.:|||.|||.|..||||:::|.|:|.||:|.|||.||||||||::
  Rat   145 VAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQR 209

  Fly   196 ARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYL 260
            |:|:||||:|::...|:.|||:||||.:|.::..: ..|.::||:|.||::|:..::.|:...||
  Rat   210 AQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSK-NPGYIKLRKIRAAQNISKTIATSQNRIYL 273

  Fly   261 PSGQSTLLNL 270
             :..:.:|||
  Rat   274 -TADNLVLNL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)37CcNP_001163012.2 SPFH_prohibitin 27..221 CDD:259799 112/194 (58%)
Phb2NP_001013053.1 Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 19..49 10/29 (34%)
PHB 39..201 CDD:214581 91/161 (57%)
SPFH_prohibitin 40..235 CDD:259799 112/194 (58%)
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 150..174 13/23 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63567
OrthoDB 1 1.010 - - D1089994at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.